PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02485.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 560aa    MW: 62962 Da    PI: 4.8807
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02485.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.55.6e-49131392128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                              +pGfrFhPtdeelv++yLk+k+ +++l++ ++i  vd+yk++P++Lp +  +k+++++w+fF++r++ky++  r+ r t++gyWka
  Rsa1.0_02485.1_g00005.1  13 APGFRFHPTDEELVMYYLKRKMCKRRLRV-NAIGVVDVYKLDPEELPrQsVLKTGDRQWFFFTPRSRKYPNAARSGRCTATGYWKA 97 
                              69***************************.89**************96357788999***************************** PP

                      NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              tgkd+ ++  +++ vglkktLvfy+grap+ge+tdWvmhey++
  Rsa1.0_02485.1_g00005.1  98 TGKDRVIVY-NSRSVGLKKTLVFYRGRAPSGERTDWVMHEYTM 139
                              ********9.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100552.00512162IPR003441NAC domain
SuperFamilySSF1019419.42E-5513162IPR003441NAC domain
PfamPF023659.0E-2614138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MAESCLKGGK FSAPGFRFHP TDEELVMYYL KRKMCKRRLR VNAIGVVDVY KLDPEELPRQ  60
SVLKTGDRQW FFFTPRSRKY PNAARSGRCT ATGYWKATGK DRVIVYNSRS VGLKKTLVFY  120
RGRAPSGERT DWVMHEYTMD EEELGRCKNA KEYYALYKLF KKSGAGPKNG EDYGAPFQEE  180
EWVDDELGDD IAVQEEPVPR YLDNRLLFNP VSVQLDDIEE ILSGIPYAPE VPQTCINGLA  240
SDIPQVNSQE ELQSTLLNNS SGEFLEPREI GEFLPNVQPY NMPSSYESTE VTSAPNDSGT  300
GPFVFEKDDY IEMDDLLTSE LGASLTETPQ QFLDPGEFGE FNEFDQLFHD VSMFLEMEPI  360
LQEDSAGPSS LSNTSDKEHQ HFQVQTPENK LYSIMDPNPN PNQLTDDMKM MIRLFSLINR  420
SLLFLEHLRH LHQVLKTQYS SLSVNVMPGS TNLTTSVTAQ DGDGGTSPFS SALWAFMDSI  480
PSTPASACEG PINRTFVRMS SFSRMRLSGK ANGTPATTTV VAKKRSRNRG FLVLSIVGAL  540
CAIFWVFIAT VRASGRPVFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-451413917140Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13138RKMCKRRL
2523528KRSRNR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013592194.10.0PREDICTED: NAC domain-containing protein 17-like
SwissprotQ9XIC50.0NAC17_ARATH; NAC domain-containing protein 17
TrEMBLA0A0D3CRV00.0A0A0D3CRV0_BRAOL; Uncharacterized protein
STRINGBra028039.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28122667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.10.0NAC domain containing protein 17